PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0641s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family G2-like
Protein Properties Length: 224aa    MW: 25190.2 Da    PI: 8.6878
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0641s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.7e-32147202156
                 G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                             k+r++W+peLH+rFv+ ++qLGG ++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  SapurV1A.0641s0120.1.p 147 KQRRCWSPELHRRFVDSLQQLGGCQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 202
                             79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.803144204IPR017930Myb domain
SuperFamilySSF466892.97E-18145205IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-29146205IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-26147202IPR006447Myb domain, plants
PfamPF002495.0E-7149200IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MQCNELNDLI PLKGNSNEDG NDKKNWMSSA QLWNANSILN CKKQDSKSEP KHKSEEEDDR  60
STCENTVQLG NHSNKGGAVV PFKALSDLEG SKRKEEKEVV SQVTGLSLVT PVPELSSCNL  120
MPLSNNCSNQ TKIQSKSQQQ QQQAYRKQRR CWSPELHRRF VDSLQQLGGC QVATPKQIRE  180
LMQVDGLTND EVKSHLQKYR LHLRKVPASS AAPENGFWKS QDR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2165991e-120AC216599.1 Populus trichocarpa clone POP051-K05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310743.11e-129hypothetical protein POPTR_0007s11470g
TrEMBLB9HE751e-129B9HE75_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11470.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-33G2-like family protein